{"product_id":"proteintech-29862-1-ap","title":"Proteintech, 29862-1-AP, ENT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ENT1 (29862-1-AP) by Proteintech is a Polyclonal antibody targeting ENT1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n29862-1-AP targets ENT1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, HeLa cells,  mouse heart tissue,  rat liver tissue,  mouse kidney tissue,  mouse liver tissue\nPositive IHC detected in: human colon cancer tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nENT1 (equilibrative nucleoside transporter 1; also known as SLC29A1) is a ubiquitous protein located at the cell membrane and is a major transporter responsible for the cellular uptake and release of endogenous nucleosides such as adenosine, and nucleoside analogs used in chemotherapy. The predicted molecular weight of ENT1 is 50 kDa, while heavier 54-68 kDa band may be observed due to the glycosylation (PMID: 16448802, 11850433, 16111480). A smaller novel splice variant of the mouse ENT1 has also been identified, which generates a protein of 35-40 kDa (PMID: 18413666).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32003 Product name: Recombinant human ENT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-82 aa of NM_001372327.1 Sequence: NFFMTATQYFTNRLDMSQNVSLVTAELSKDAQASAAPAAPLPERNSLSAIFNN Predict reactive species\nFull Name: solute carrier family 29 (nucleoside transporters), member 1\nCalculated Molecular Weight: 50KD\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: NM_001372327.1\nGene Symbol: ENT1\nGene ID (NCBI): 2030\nRRID: AB_2935484\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99808\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869405040809,"sku":"29862-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29862-1-ap","provider":"Iright","version":"1.0","type":"link"}