{"product_id":"proteintech-29899-1-ap","title":"Proteintech, 29899-1-AP, TNFSF15 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TNFSF15 (29899-1-AP) by Proteintech is a Polyclonal antibody targeting TNFSF15 in WB, ELISA applications with reactivity to human, mouse, rat samples\n29899-1-AP targets TNFSF15 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue, mouse small intestine tissue,  rat small intestine tissue,  rat colon tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTumor necrosis factor ligand superfamily member 15 (TNFSF15) is also named as TL1 and VEGI. And it belongs to the tumor necrosis factor family. It is a receptor for TNFRSF25 and TNFRSF6B. VEGI induced degradation of IκB alpha, and nuclear translocation of p65 subunit of NFκB by activating NFκB (PMID: 10597252). TL1A mediates activation and apoptosis of NFκB in DR3-expressing cell lines (PMID: 11911831). Overexpression by cancer cells of a secretable VEGI fusion protein resulted in abrogation of xenograft tumor progression. The isoforms show endothelial cell-specific expression and are generated from a 17 kb human gene by alternative splicing  (PMID: 11923219). In addition, VEGI can inhibit vascular endothelial growth and angiogenesis (in vitro) (PMID: 9872942).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg32092 Product name: Recombinant Human TL1A\/TNFSF15 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: N-6*his Domain: 72-251 aa of BC074941 Sequence: LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL Predict reactive species\nFull Name: tumor necrosis factor (ligand) superfamily, member 15\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC074941\nGene Symbol: TNFSF15\nGene ID (NCBI): 9966\nRRID: AB_3086184\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95150\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869618294953,"sku":"29899-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29899-1-ap","provider":"Iright","version":"1.0","type":"link"}