{"product_id":"proteintech-29906-1-ap","title":"Proteintech, 29906-1-AP, Hamartin\/TSC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Hamartin\/TSC1 (29906-1-AP) by Proteintech is a Polyclonal antibody targeting Hamartin\/TSC1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n29906-1-AP targets Hamartin\/TSC1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse kidney tissue,  MCF-7 cells\nPositive IHC detected in: mouse kidney tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: hTERT-RPE1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTSC1, also named as hamartin, interacts with TSC2 to form a protein complex that inhibits the nutrient-mediated or growth factor-stimulated phosphorylation of S6K1 and EIF4EBP1 by negatively regulating mTORC1 signaling (PubMed: 12271141, PubMed: 28215400). It can recruit TSC2 to HSP90AA1 and stabilizes TSC2 by preventing the interaction between TSC2 and ubiquitin ligase HERC1 (PubMed: 16464865, PubMed: 29127155). The loss of TSC1\/TSC2 in mouse neurons resulted in a block in oligodendrocyte hypomyelination in vivo (PubMed: 28183733).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31621 Product name: Recombinant human TSC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 965-1164 aa of NM_000368 Sequence: LYGRLEKDGLLKKLEEEKAEAAEAAEERLDCCNDGCSDSMVGHNEEASGHNGETKTPRPSSARGSSGSRGGGGSSSSSSELSTPEKPPHQRAGPFSSRWETTMGEASASIPTTVGSLPSSKSFLGMKARELFRNKSESQCDEDGMTSSLSESLKTELGKDLGVEAKIPLNLDGPHPSPPTPDSVGQLHIMDYNETHHEHS Predict reactive species\nFull Name: tuberous sclerosis 1\nCalculated Molecular Weight: 130KD\nObserved Molecular Weight: 140-145 kDa\nGenBank Accession Number: NM_000368\nGene Symbol: Hamartin\/TSC1\nGene ID (NCBI): 7248\nRRID: AB_2918352\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92574\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868999110825,"sku":"29906-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29906-1-ap","provider":"Iright","version":"1.0","type":"link"}