{"product_id":"proteintech-29931-1-ap","title":"Proteintech, 29931-1-AP, SERPINA6\/CBG Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SERPINA6\/CBG (29931-1-AP) by Proteintech is a Polyclonal antibody targeting SERPINA6\/CBG in WB, IHC, IP, ELISA applications with reactivity to human samples\n29931-1-AP targets SERPINA6\/CBG in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma\nPositive IP detected in: human placenta tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSERPINA6, also known as corticosteroid-binding globulin or CBG, belongs to the serpin family of serine protease inhibitors, and is mainly secreted by the liver. It is an alpha-globulin protein with corticosteroid-binding properties, and involved in obesity and stress sensitivity. It is also the major transport protein for glucorticoids and progestins in the blood of most vertebrates. Defects in SERPINA6 are a cause of corticosteroid-binding globulin deficiency (CBG deficiency).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31861 Product name: Recombinant human Corticosteroid binding globulin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 268-405 aa of BC058021 Sequence: PDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV Predict reactive species\nFull Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6\nCalculated Molecular Weight: 405 aa, 45 kDa\nObserved Molecular Weight: 45-55 kDa\nGenBank Accession Number: BC058021\nGene Symbol: SERPINA6\nGene ID (NCBI): 866\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08185\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887797358761,"sku":"29931-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29931-1-ap","provider":"Iright","version":"1.0","type":"link"}