{"product_id":"proteintech-29941-1-ap","title":"Proteintech, 29941-1-AP, UNC5D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UNC5D (29941-1-AP) by Proteintech is a Polyclonal antibody targeting UNC5D in WB, ELISA applications with reactivity to Human, mouse, rat samples\n29941-1-AP targets UNC5D in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse kidney tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUNC5D, also named as KIAA1777 and UNC5H4, belongs to the unc-5 family. It is a receptor for netrin. It may be involved in axon guidance by mediating axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding. Axon repulsion in growth cones may be caused by its association with DCC that may trigger signaling for repulsion. It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand. Previous studies have demonstrated that UNC5D can be cleavaged by caspase 2 and 3, suggesting that UNC5D serves as a direct substrate for caspases 2 and 3 (PMID: 23778138).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31973 Product name: Recombinant human UNC5D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-152 aa of NM_080872 Sequence: ARGTDNGEALPESIPSAPGTLPHFIEEPDDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEETLDESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWSHLGTSKSRKASV Predict reactive species\nFull Name: unc-5 homolog D (C. elegans)\nCalculated Molecular Weight: 106KD\nObserved Molecular Weight: 120 kDa, 68 kDa\nGenBank Accession Number: NM_080872\nGene Symbol: UNC5D\nGene ID (NCBI): 137970\nRRID: AB_3086195\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UXZ4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887917256873,"sku":"29941-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29941-1-ap","provider":"Iright","version":"1.0","type":"link"}