{"product_id":"proteintech-29942-1-ap","title":"Proteintech, 29942-1-AP, DSG3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DSG3 (29942-1-AP) by Proteintech is a Polyclonal antibody targeting DSG3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n29942-1-AP targets DSG3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HaCaT cells\nPositive IHC detected in: mouse tongue tissue, human lung squamous cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HaCaT cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDSG3, Desmoglein-3, is the component of intercellular desmosome junctions. Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. DSG3 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. DSG3 is expressed in the basal lower layers of in the skin epidermis (PMID: 30528827). It acts as a prognostic marker of Esophageal Squamous cell carcinoma (PMID:24568510).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30880 Product name: Recombinant human DSG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 760-880 aa of NM_001944 Sequence: SGQSGTMRTRHSTGGTNKDYADGAISMNFLDSYFSQKAFACAEEDDGQEANDCLLIYDNEGADATGSPVGSVGCCSFIADDLDDSFLDSLGPKFKKLAEISLGVDGEGKEVQPPSKDSGYG Predict reactive species\nFull Name: desmoglein 3 (pemphigus vulgaris antigen)\nCalculated Molecular Weight: 108 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: NM_001944\nGene Symbol: DSG3\nGene ID (NCBI): 1830\nRRID: AB_3086196\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P32926\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869676654761,"sku":"29942-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29942-1-ap","provider":"Iright","version":"1.0","type":"link"}