{"product_id":"proteintech-29971-1-ap","title":"Proteintech, 29971-1-AP, TRPV3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRPV3 (29971-1-AP) by Proteintech is a Polyclonal antibody targeting TRPV3 in IHC, ELISA applications with reactivity to Human samples\n29971-1-AP targets TRPV3 in IHC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTransient receptor potential cation channel, subfamily V, member 3, also known as TRPV3, is a human gene encoding the protein of the same name. The TRPV3 protein belongs to a family of nonselective cation channels that function in a variety of processes, including temperature sensation and vasoregulation. The thermosensitive members of this family are expressed in subsets of human sensory neurons that terminate in the skin, and are activated at distinct physiological temperatures. The TRPV3 channel has wide tissue expression that is especially high in the skin (keratinocytes) but also in the brain. It functions as a molecular sensor for innocuous warm temperatures.( PMID 12016205)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32437 Product name: Recombinant human TRPV3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 671-790 aa of NM_001258205 Sequence: NMLIALMGETVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETSV Predict reactive species\nFull Name: transient receptor potential cation channel, subfamily V, member 3\nCalculated Molecular Weight: 91kd\nGenBank Accession Number: NM_001258205\nGene Symbol: TRPV3\nGene ID (NCBI): 162514\nRRID: AB_3086200\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NET8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887840383145,"sku":"29971-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29971-1-ap","provider":"Iright","version":"1.0","type":"link"}