{"product_id":"proteintech-30007-1-ap","title":"Proteintech, 30007-1-AP, LGR5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LGR5 (30007-1-AP) by Proteintech is a Polyclonal antibody targeting LGR5 in WB, ELISA applications with reactivity to human, mouse, rat samples\n30007-1-AP targets LGR5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BGC-823 cells, mouse brain tissue,  HEK-293 cells,  SGC-7901 cells,  SKOV-3 cells,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLeucine-rich repeat-containing G-protein coupled receptor 5 (LGR5) also known as G-protein coupled receptor 49 (GPR49) or G-protein coupled receptor 67 (GPR67) is a protein that in humans is encoded by the LGR5 gene. It is a member of GPCR class A receptor proteins. R-spondin proteins are the biological ligands of LGR5. LGR5 is expressed across a diverse range of tissue such as in the muscle, placenta, spinal cord and brain and particularly as a biomarker of adult stem cells in certain tissues.LGR5 is crucial during embryogenesis as LGR null studies in mice incurred 100% neonatal mortality accompanied by several craniofacial distortions such as ankyloglossia and gastrointestinal dilation (PMID: 9642114, 16575208, 525477).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31625 Product name: Recombinant human LGR5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 824-907 aa of BC096324 Sequence: NPHFKEDLVSLRKQTYVWTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSSVAFVPCL Predict reactive species\nFull Name: leucine-rich repeat-containing G protein-coupled receptor 5\nCalculated Molecular Weight: 907 aa, 100 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC096324\nGene Symbol: LGR5\nGene ID (NCBI): 8549\nRRID: AB_3086207\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75473\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868983513257,"sku":"30007-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30007-1-ap","provider":"Iright","version":"1.0","type":"link"}