{"product_id":"proteintech-30022-1-ap","title":"Proteintech, 30022-1-AP, HIP14\/ZDHHC17 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HIP14\/ZDHHC17 (30022-1-AP) by Proteintech is a Polyclonal antibody targeting HIP14\/ZDHHC17 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n30022-1-AP targets HIP14\/ZDHHC17 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293T cells,  Raji cells,  U-251 cells,  mouse brain tissue,  rat brain tissue\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZDHHC17 is a neuronal palmitoyl transferase. Post-translational modification by the lipid palmitate is crucial for the correct targeting and function of many proteins. Polyglutamine expansions of huntingtin protein are responsible for the Huntington neurological disorder. ZDHHC17 gene encodes palmitoyl transferase huntingtin interacting protein (HIP14) which regulates palmitoylation and distribution of hungtingtin. The latter is implicated in the formation of inclusion bodies and enhanced neuronal toxicity. HIP14 was also shown to control neurotransmitter release.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32654 Product name: Recombinant human HIP14; ZDHHC17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-203 aa of BC050324 Sequence: MQREEGFNTKMADGPDEYDTEAGCVPLLHPEEIKPQSHYNHGYGEPLGRKTHIDDYSTWDIVKATQYGIYERCRELVEAGYDVRQPDKENVTLLHWAAINNRIDLVKYYISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHS Predict reactive species\nFull Name: zinc finger, DHHC-type containing 17\nCalculated Molecular Weight: 73 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC050324\nGene Symbol: ZDHHC17\nGene ID (NCBI): 23390\nRRID: AB_2935500\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IUH5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887667892393,"sku":"30022-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30022-1-ap","provider":"Iright","version":"1.0","type":"link"}