{"product_id":"proteintech-30031-1-ap","title":"Proteintech, 30031-1-AP, SLC43A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC43A2 (30031-1-AP) by Proteintech is a Polyclonal antibody targeting SLC43A2 in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n30031-1-AP targets SLC43A2 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 37°C incubated mouse kidney tissue, mouse kidney tissue,  mouse liver tissue,  mouse liver tissue (37℃ incubated),  rat liver tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human lung cancer tissue\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC43A2 (solute carrier family 43 member 2, also known as LAT4) is a multi-pass transmembrane protein that mediates sodium- and chloride-independent uptake of large neutral amino acids, including methionine, leucine and phenylalanine. Highly expressed in kidney, placenta and liver, it supplies essential amino acids to support fetal growth, protein synthesis and one-carbon metabolism. Over-expressed in head-and-neck, liver and other cancers, SLC43A2-driven methionine influx maintains methylation reactions and YAP activity, promoting tumor proliferation and chemo-resistance . Pharmacological inhibition of SLC43A2 sensitizes tumors to therapy, highlighting its potential as a metabolic target. (PMID: 39747898; 15659399; 30379325)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31341 Product name: Recombinant human SLC43A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 516-569 aa of BC027923 Sequence: WVNVGLLLLSLLGFCLPLYLICYRRQLERQLQQRQEDDKLFLKINGSSNQEAFV Predict reactive species\nFull Name: solute carrier family 43, member 2\nCalculated Molecular Weight: 63 kDa\nObserved Molecular Weight: 48-53 kDa\nGenBank Accession Number: BC027923\nGene Symbol: SLC43A2\nGene ID (NCBI): 124935\nRRID: AB_3086213\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N370\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887806959785,"sku":"30031-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30031-1-ap","provider":"Iright","version":"1.0","type":"link"}