{"product_id":"proteintech-30041-1-ap","title":"Proteintech, 30041-1-AP, KEAP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KEAP1 (30041-1-AP) by Proteintech is a Polyclonal antibody targeting KEAP1 in WB, ELISA applications with reactivity to Human samples\n30041-1-AP targets KEAP1 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  Jurkat cells,  MCF-7 cells,  NK-92 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKEAP1, also named as INRF2, KIAA0132 and KLHL19, is part of a multiprotein complex that contains the CUL3-ROC1 ubiquitin ligase, which can ubiquitinate the N-terminal domain of NRF2[PMID: 20173742]. Two molecules of KEAP1 bind to two distinct sites in the N-terminal region of NRF2, the ETGE and DLG sites, which affect the KEAP1-NRF2 interaction and\/or its physiological consequences[PMID: 22215675]. KEAP1 retains NFE2L2\/NRF2 in the cytosol. It functions as substrate adapter protein for the E3 ubiquitin ligase complex formed by CUL3 and RBX1[PMID: 20427290]. It also retains BPTF in the cytosol.  This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human KEAP1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32512 Product name: Recombinant human KEAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 480-624 aa of BC002930 Sequence: GTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC Predict reactive species\nFull Name: kelch-like ECH-associated protein 1\nCalculated Molecular Weight: 624 aa, 70 kDa\nObserved Molecular Weight: 55-70 kDa\nGenBank Accession Number: BC002930\nGene Symbol: KEAP1\nGene ID (NCBI): 9817\nRRID: AB_2935506\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14145\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887694041257,"sku":"30041-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30041-1-ap","provider":"Iright","version":"1.0","type":"link"}