{"product_id":"proteintech-30042-1-ap","title":"Proteintech, 30042-1-AP, RACGAP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RACGAP1 (30042-1-AP) by Proteintech is a Polyclonal antibody targeting RACGAP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human samples\n30042-1-AP targets RACGAP1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  K-562 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32468 Product name: Recombinant human RACGAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 540-632 aa of BC032754 Sequence: SQFMMVEQENIDPLHVIENSNAFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPMLK Predict reactive species\nFull Name: Rac GTPase activating protein 1\nCalculated Molecular Weight: 632 aa, 71 kDa\nObserved Molecular Weight: 71 kDa\nGenBank Accession Number: BC032754\nGene Symbol: RACGAP1\nGene ID (NCBI): 29127\nRRID: AB_3086216\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H0H5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887778779305,"sku":"30042-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30042-1-ap","provider":"Iright","version":"1.0","type":"link"}