{"product_id":"proteintech-30045-1-ap","title":"Proteintech, 30045-1-AP, Collagen Type XII Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Collagen Type XII (30045-1-AP) by Proteintech is a Polyclonal antibody targeting Collagen Type XII in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n30045-1-AP targets Collagen Type XII in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, HeLa cells,  SKOV-3 cells,  C2C12 cells\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOL12A1 (Collagen alpha-1(XII) chain), also known as COL12A1L. It is predicted to be located in the ECM. Type XII collagen interacts with type I collagen-containing fibrils, the COL1 domain could be associated with the surface of the fibrils, and the COL2 and NC3 domains may be localized in the perifibrillar matrix. The molecular weight of COL12A1 is 333 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32602 Product name: Recombinant human COL12A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 768-892 aa of NM_004370 Sequence: VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAG Predict reactive species\nFull Name: collagen, type XII, alpha 1\nCalculated Molecular Weight: 333kd\nObserved Molecular Weight: 310-333 kDa\nGenBank Accession Number: NM_004370\nGene Symbol: COL12A1\nGene ID (NCBI): 1303\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99715\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886761726121,"sku":"30045-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30045-1-ap","provider":"Iright","version":"1.0","type":"link"}