{"product_id":"proteintech-30061-1-ap","title":"Proteintech, 30061-1-AP, CDK10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDK10 (30061-1-AP) by Proteintech is a Polyclonal antibody targeting CDK10 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n30061-1-AP targets CDK10 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, K-562 cells,  THP-1 cells,  U2OS cells,  C2C12 cells\nPositive IF\/ICC detected in: hTERT-RPE1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCyclin-dependent kinase 10 (CDK10) is a Cdc2-related kinase that was discovered based on its homology to the Cdc2 PSTA1RE amino acid domain (PMID: 8208557). CDK10 plays a pivotal role in the regulation of fundamental cellular processes, including cell proliferation, transcription regulation, and cell cycle regulation. It partners with cyclin M to phosphorylate substrates such as ETS2 and PKN2 in order to modulate cellular growth. Initial reports have indicated that CDK10 may act as a tumor suppressor in breast cancer (PMID: 26392360). Additional studies have demonstrated tumor suppressive and oncogenic roles for CDK10 in malignancies such as hepatobiliary cancers, gastric cancer, glioma, nasopharyngeal carcinoma, and colorectal cancer(PMID: 22326270, PMID: 29512714, PMID: 23740091, PMID: 29845196)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30365 Product name: Recombinant human CDK10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 190-283 aa of BC017342 Sequence: NIWPGFSKLPLVGQYSLRKQPYNNLKHKFPWLSEAGLRLLHFLFMATAGDCLESSYFKEKPLPCEPELMPTFPHHRNKRAAPATSEGQSKRCKP Predict reactive species\nFull Name: cyclin-dependent kinase 10\nCalculated Molecular Weight: 283 aa, 32 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC017342\nGene Symbol: CDK10\nGene ID (NCBI): 8558\nRRID: AB_2935507\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15131\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869654536361,"sku":"30061-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30061-1-ap","provider":"Iright","version":"1.0","type":"link"}