{"product_id":"proteintech-30082-1-ap","title":"Proteintech, 30082-1-AP, FOXC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FOXC1 (30082-1-AP) by Proteintech is a Polyclonal antibody targeting FOXC1 in WB, ELISA applications with reactivity to human samples\n30082-1-AP targets FOXC1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFOXC1, also named as FKHL7 and FREAC3, binding of FREAC-3 and FREAC-4 to their cognate sites results in bending of the DNA at an angle of 80-90 degrees. Defects in FOXC1 are the cause of Axenfeld-Rieger syndrome type 3 (RIEG3). Defects in FOXC1 are the cause of iridogoniodysgenesis anomaly (IGDA). Defects in FOXC1 are a cause of Peters anomaly. This antibody is specific to FOXC1. \nPhosphorylation modification of Foxc1 protein may be responsible for the larger molecular weight of detection compared with theoretical molecular weight (PMID:27708239;16403239).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32531 Product name: Recombinant human FOXC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 404-553 aa of NM_001453.3 Sequence: AAGERGGHLQGAPGGAGGSAVDDPLPDYSLPPVTSSSSSSLSHGGGGGGGGGGQEAGHHPAAHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF Predict reactive species\nFull Name: forkhead box C1\nCalculated Molecular Weight: 57kd\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: NM_001453.3\nGene Symbol: FOXC1\nGene ID (NCBI): 2296\nRRID: AB_2935512\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q12948\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868843036841,"sku":"30082-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30082-1-ap","provider":"Iright","version":"1.0","type":"link"}