{"product_id":"proteintech-30086-1-ap","title":"Proteintech, 30086-1-AP, PTRF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTRF (30086-1-AP) by Proteintech is a Polyclonal antibody targeting PTRF in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n30086-1-AP targets PTRF in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HT-1080 cells,  NIH\/3T3 cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:800-1:3200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPolymerase I and transcript release factor(PTRF) is an essential factor in the biogenesis of caveolae, which involve in numerous process, such as signal transduction and membrane and lipid trafficking. PTRF can terminate transcription of RNA Pol I, which involves pausing of transcription by TTF1, and dissociation of the transcription complex, release the complex from the template. The calculated molecular weight of PTRF is 43 kDa, but modified PTRF is about 50-55 kDa. (PMID: 11139612 )\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32786 Product name: Recombinant human PTRF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC008849 Sequence: MEDAAALELSSDEAVEVEEVIEESRAERIKRSGLRRVDDFKKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKSFT Predict reactive species\nFull Name: polymerase I and transcript release factor\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC008849\nGene Symbol: PTRF\nGene ID (NCBI): 284119\nRRID: AB_2935513\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6NZI2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887777468585,"sku":"30086-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30086-1-ap","provider":"Iright","version":"1.0","type":"link"}