{"product_id":"proteintech-30104-1-ap","title":"Proteintech, 30104-1-AP, GPR151 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR151 (30104-1-AP) by Proteintech is a Polyclonal antibody targeting GPR151 in WB, IHC, ELISA applications with reactivity to human samples\n30104-1-AP targets GPR151 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells\nPositive IHC detected in: mouse brain tissue, human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nG protein-coupled receptors (GPCRs) are a superfamily of cell-surface receptors which are important for intracellular signal transduction. GPR151 (G protein-coupled receptor 151) is highly enriched in the the medial and lateral habenula and is expressed at presynaptic membranes and synaptic vesicles (PMID: 32098843). GPR151 has been reported to play an important role in modulating neuropathic pain and controling nicotine addiction vulnerability (PMID: 32098843,34244727,30373770).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32442 Product name: Recombinant human GPR151 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 308-419 aa of NM_194251 Sequence: VMSEEFREGLKGVWKWMITKKPPTVSESQETPAGNSEGLPDKVPSPESPASIPEKEKPSSPSSGKGKTEKAEIPILPDVEQFWHERDTVPSVQDNDPIPWEHEDQETGEGVK Predict reactive species\nFull Name: G protein-coupled receptor 151\nCalculated Molecular Weight: 47kd\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: NM_194251\nGene Symbol: GPR151\nGene ID (NCBI): 134391\nRRID: AB_3086229\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TDV0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887656620201,"sku":"30104-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30104-1-ap","provider":"Iright","version":"1.0","type":"link"}