{"product_id":"proteintech-30108-1-ap","title":"Proteintech, 30108-1-AP, DDAH1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDAH1 (30108-1-AP) by Proteintech is a Polyclonal antibody targeting DDAH1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n30108-1-AP targets DDAH1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, SH-SY5Y cells,  mouse brain tissue\nPositive IHC detected in: mouse brain tissue, human stomach cancer tissue,  rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDimethylarginine dimethylaminohydrolase 1 (DDAH1) is an enzyme that can degrade asymmetric dimethylarginine (ADMA), an endogenous nitric oxide synthase (NOS)inhibitor (PMID:26996393). About 80% of endogenous ADMA is metabolized by DDAH, principally the DDAH1 isoform (PMID:22460174). It was reported that DDAH1 is highly expressed in vascular endothelial cells in hearts (PMID:19917889). The observed molecular weight of DDAH1 is 35-40 kDa in the literature.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32516 Product name: Recombinant human DDAH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 168-285 aa of NM_012137 Sequence: VADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS Predict reactive species\nFull Name: dimethylarginine dimethylaminohydrolase 1\nCalculated Molecular Weight: 31kd\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: NM_012137\nGene Symbol: DDAH1\nGene ID (NCBI): 23576\nRRID: AB_2935515\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O94760\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887100285097,"sku":"30108-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30108-1-ap","provider":"Iright","version":"1.0","type":"link"}