{"product_id":"proteintech-30112-1-ap","title":"Proteintech, 30112-1-AP, TTC21B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TTC21B (30112-1-AP) by Proteintech is a Polyclonal antibody targeting TTC21B in WB, IHC, ELISA applications with reactivity to Human, mouse samples\n30112-1-AP targets TTC21B in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  K-562 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTTC21B, also known as THM1, IFT139, belongs to the TTC21 family, containing several tetratricopeptide repeat (TPR) domains. TTC21B is a component of the IFT complex A (IFT-A), a complex required for retrograde ciliary transport and entry into cilia of G protein-coupled receptors (GPCRs). TTC21B is essential for retrograde trafficking of IFT-1, IFT-B, and GPCRs (PubMed:27932497). TTC21B is localized to the cilium axoneme and may play a role in retrograde intraflagellar transport in cilia (PMID: 18327258). Mutations in TTC21B are associated with nephronophthisis 12 (NPHP12)and short-rib thoracic dysplasia 4 with or without polydactyly (SRTD4)(PMID: 21258341).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32456 Product name: Recombinant human TTC21B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 149-462 aa of NM_024753 Sequence: AWLDITRGKEPYTKKALKYFEEGLQDGNDTFALLGKAQCLEMRQNYSGALETVNQIIVNFPSFLPAFVKKMKLQLALQDWDQTVETAQRLLLQDSQNVEALRMQALYYVCREGDIEKASTKLENLGNTLDAMEPQNAQLFYNITLAFSRTCGRSQLILQKIQTLLERAFSLNPQQSEFATELGYQMILQGRVKEALKWYKTAMTLDETSVSALVGFIQCQLIEGQLQDADQQLEFLNEIQQSIGKSAELIYLHAVLAMKKNKRQEEVINLLNDVLDTHFSQLEGLPLGIQYFEKLNPDFLLEIVMEYLSFCPMQ* Predict reactive species\nFull Name: tetratricopeptide repeat domain 21B\nCalculated Molecular Weight: 151KD\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: NM_024753\nGene Symbol: TTC21B\nGene ID (NCBI): 79809\nRRID: AB_3086232\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z4L5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887909982377,"sku":"30112-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30112-1-ap","provider":"Iright","version":"1.0","type":"link"}