{"product_id":"proteintech-30114-1-ap","title":"Proteintech, 30114-1-AP, NFATC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NFATC1 (30114-1-AP) by Proteintech is a Polyclonal antibody targeting NFATC1 in WB, IF\/ICC, ELISA applications with reactivity to Human samples\n30114-1-AP targets NFATC1 in WB, IF\/ICC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNuclear factor of activated T-cells cytoplasmic (NFATC) is a family of transcription factors originally identified in T-cells. The family has five members (NFATC1 through NFATC5), which play roles both within and outside the immune system. NFATC1 is widely expressed and resides in endocardial cushion endothelial cells, skeletal muscle fibers, T lymphocytes, osteoblasts, osteoclasts, etc. The autoregulation of NFATC1 is a crucial step for cell fate determination. It is a master regulator of RANKL-induced osteoclast differentiation and plays a pivotal role in osteoclast fusion and osteoclast activation via up-regulation of various genes responsible for osteoclast adhesion, migration, acidification, degradation of inorganic and organic bone matrix (PMID: 20035895, PMID: 19754901). NFAT proteins is alternatively modified to generate splice variants. NFATC1 can be detected isoforms of 82-140 kDa (PMID: 18097033).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32365 Product name: Recombinant human NFATC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 197-304 aa of BC104753 Sequence: YASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNT Predict reactive species\nFull Name: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1\nCalculated Molecular Weight: 716aa,78 kDa; 943aa,101 kDa\nObserved Molecular Weight: 82-140 kDa\nGenBank Accession Number: BC104753\nGene Symbol: NFATC1\nGene ID (NCBI): 4772\nRRID: AB_3086233\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95644\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887735787689,"sku":"30114-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30114-1-ap","provider":"Iright","version":"1.0","type":"link"}