{"product_id":"proteintech-30119-1-ap","title":"Proteintech, 30119-1-AP, RIF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RIF1 (30119-1-AP) by Proteintech is a Polyclonal antibody targeting RIF1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse samples\n30119-1-AP targets RIF1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HEK-293T cells,  HT-29 cells,  HeLa cells,  HepG2 cells,  MCF-7 cells\nPositive IHC detected in: human cervical cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:600-1:2400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRIF1 (Rap1-interacting factor 1) is a multifunctional chromosome stability protein implicated in controlling DNA replication and repair. Human RIF1 can interact with protein phosphatase 1 (PP1) and the interaction is crucial for controlling DNA replication by limiting phosphorylation of the MCM complex (PMID: 28077461). RIF1 also acts with PP1 to protect nascent DNA from overdegradation at stalled replication forks (PMID: 31141682). RIF1 promotes non-homologous end joining (NHEJ) in double strand break (DSB) repair (PMID: 30443189). Research studies show that RIF1 is overexpressed in breast cancer tissues and is upgraded in NSCLC tissues (PMID: 30237512).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32422 Product name: Recombinant human RIF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2277-2472 aa of NM_001177663.1 Sequence: SEMAKESIPCPTESVYPPLVNCVAPVDIILPQITSNMWARGLGQLIRAKNIKTIGDLSTLTASEIKTLPIRSPKVSNVKKALRIYHEQQVKTRGLEEIPVFDISEKTVNGIENKSLSPDEERLVSDIIDPVALEIPLSKNLLAQISALALQLDSEDLHNYSGSQLFEMHEKLSCMANSVIKNLQSRWRSPSHENSI Predict reactive species\nFull Name: RAP1 interacting factor homolog (yeast)\nCalculated Molecular Weight: 274 kDa\nObserved Molecular Weight: 300 kDa\nGenBank Accession Number: NM_001177663.1\nGene Symbol: RIF1\nGene ID (NCBI): 55183\nRRID: AB_2935516\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5UIP0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887784906921,"sku":"30119-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30119-1-ap","provider":"Iright","version":"1.0","type":"link"}