{"product_id":"proteintech-30120-1-ap","title":"Proteintech, 30120-1-AP, ST3GAL5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ST3GAL5 (30120-1-AP) by Proteintech is a Polyclonal antibody targeting ST3GAL5 in WB, IF\/ICC, ELISA applications with reactivity to Human, mouse samples\n30120-1-AP targets ST3GAL5 in WB, IF\/ICC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  Jurkat cells,  human placenta tissue,  mouse testis tissue\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nST3GAL5 is also named as SIAT9, GM3 synthase, ST3Gal V, Sialyltransferase 9 and belongs to the glycosyltransferase 29 family. ST3GAL5 transfers the sialyl group (N-acetyl-alpha-neuraminyl or NeuAc) from CMP-NeuAc to the non-reducing terminal galactose of glycosphingolipids forming gangliosides (PMID:9822625, PMID:16934889). SIAT9 is mainly involved in the biosynthesis of ganglioside GM3 but can also use different glycolipids as substrate acceptors such as D-galactosylceramide (GalCer), asialo-GM2 (GA2) and asialo-GM1 (GA1) (PMID:16934889). ST3GAL5 is high expression in brain, skeletal muscle, placenta, and testis. And mRNA of ST3GAL5 is widely distributed in human brain, but slightly elevated expression was observed in the cerebral cortex, temporal lobe, and putamen (PMID:9822625). This antibody recognizes the glycosylated form of ST3GAL5 (PMID: 34943806, PMID: 26458842).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32461 Product name: Recombinant human ST3GAL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 230-418 aa of BC065936 Sequence: YSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLATHLCDEVSLAGFGYDLNQPRTPLHYFDSQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF Predict reactive species\nFull Name: ST3 beta-galactoside alpha-2,3-sialyltransferase 5\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC065936\nGene Symbol: ST3GAL5\nGene ID (NCBI): 8869\nRRID: AB_3086237\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UNP4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887817347241,"sku":"30120-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30120-1-ap","provider":"Iright","version":"1.0","type":"link"}