{"product_id":"proteintech-30132-1-ap","title":"Proteintech, 30132-1-AP, C4orf26 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C4orf26 (30132-1-AP) by Proteintech is a Polyclonal antibody targeting C4orf26 in IHC, ELISA applications with reactivity to human samples\n30132-1-AP targets C4orf26 in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nChromosome 4 open reading frame 26 (C4orf26), also known as odontogenesis associated phosphoprotein (ODAPH), is an enamel matrix protein at the maturation stage.  It has been reported that mutations in C4orf26 gene are associated with autosomal recessive type of Amelogenesis Imperfecta (AI), a hereditary condition that affects enamel formation\/mineralization (PMID: 33884476; PMID: 36163390).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32600 Product name: Recombinant human C4orf26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-130 aa of NM_001206981 Sequence: QEEVFTPPGDSQNNADATDCQIFTLTPPPAPRSPVTRAQPITKTPRCPFHFFPRRPRIHFRFPNRPFVPSRCNHRFPFQPFYWPHRYLTYRYFPRRRLQRGSSSEES Predict reactive species\nFull Name: chromosome 4 open reading frame 26\nCalculated Molecular Weight: 16kd\nGenBank Accession Number: NM_001206981\nGene Symbol: C4orf26\nGene ID (NCBI): 152816\nRRID: AB_3086240\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q17RF5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885613568169,"sku":"30132-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30132-1-ap","provider":"Iright","version":"1.0","type":"link"}