{"product_id":"proteintech-30168-1-ap","title":"Proteintech, 30168-1-AP, HIV-1-P24 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HIV-1-P24 (30168-1-AP) by Proteintech is a Polyclonal antibody targeting HIV-1-P24 in WB, ELISA applications with reactivity to recombinant protein samples\n30168-1-AP targets HIV-1-P24 in WB, ELISA applications and shows reactivity with recombinant protein samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Recombinant protein\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe HIV virus is composed of core RNA, capsid, and the outermost envelope. Among them, the capsid is only composed of P24 protein, which is the product of structural gene GAG. GAG encodes a 55kda GAG protein P55, which is cleaved into capsid P24 by protease H. P24 surrounds the core genomic RNA of the HIV virus particles, forming a firm conical nucleocapsid complex. In addition, due to the high conservativeness of the GAG gene sequence, the P24 protein amino acid sequence is also highly conservative in different strains of HIV, so it can be used as a detection of antigen in HIV infection.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: recombinant protein\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32891 Product name: Recombinant hiv-1 HIV-1-P24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 133-363 aa of NP_057850 Sequence: PIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL Predict reactive species\nFull Name: Gag polyprotein\nCalculated Molecular Weight: 24 kDa\nGenBank Accession Number: NP_057850\nGene Symbol: HIV-1-P24\nGene ID (NCBI): 155030\nRRID: AB_2935522\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P04591\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887668514985,"sku":"30168-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30168-1-ap","provider":"Iright","version":"1.0","type":"link"}