{"product_id":"proteintech-30173-1-ap","title":"Proteintech, 30173-1-AP, DDB2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDB2 (30173-1-AP) by Proteintech is a Polyclonal antibody targeting DDB2 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples\n30173-1-AP targets DDB2 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, PC-12 cells,  HCT 116 cells,  HeLa cells,  HepG2 cells,  Jurkat cells,  NIH\/3T3 cells,  mouse kidney tissue,  mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDDB2, also named as DNA damage-binding protein 2 or UV-damaged DNA-binding protein 2, is a 427 amino acid protein, which contains seven WD repeats and belongs to the WD repeat DDB2\/WDR76 family. DDB2 is ubiquitously expressed, with highest levels in corneal endothelium and lowest levels in brain. DDB2 localizes in the nucleus and is required for DNA repair. DDB2 regulates negatively the constitutive expression of the SOD2 gene in breast cancer cells and exerts, at least in part, a control of breast cancer cell growth. DDB2 can play a role as oncogene and may become a promising candidate as a predictive marker in breast cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32811 Product name: Recombinant human DDB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 46-320 aa of NM_000107 Sequence: RRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRMHKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDGARLLTTDQKSEIRVYSASQW Predict reactive species\nFull Name: damage-specific DNA binding protein 2, 48kDa\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 48-51 kDa\nGenBank Accession Number: NM_000107\nGene Symbol: DDB2\nGene ID (NCBI): 1643\nRRID: AB_2935524\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92466\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887102382249,"sku":"30173-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30173-1-ap","provider":"Iright","version":"1.0","type":"link"}