{"product_id":"proteintech-30246-1-ap","title":"Proteintech, 30246-1-AP, C16orf74 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C16orf74 (30246-1-AP) by Proteintech is a Polyclonal antibody targeting C16orf74 in WB, IHC, ELISA applications with reactivity to human samples\n30246-1-AP targets C16orf74 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, SW 1990 cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe C16orf74 has been reported associated with tumor necrosis factor (TNF)-alpha as well as hypoxic condition. Moreover, several reports have indicated that C16orf74 expression is a potential prognostic factor in several types of cancer. The results of several genome-wide studies have indicated that C16orf74 is involved in inflammatory processes. C16orf74 is overexpressed in the vast majority of human PDAC(Clinical outcome of pancreatic ductal adenocarcinoma), and likely plays a significant role in pancreatic cell growth and invasion through its interaction with PPP3CA.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32878 Product name: Recombinant human C16orf74 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 10-76 aa of BC009078 Sequence: GFQMCVSSSSSSHDEAPVLNDKHLDVPDIIITPPTPTGMMLPRDLGSTVWLDETGSCPDDGEIDPEA Predict reactive species\nFull Name: chromosome 16 open reading frame 74\nObserved Molecular Weight: 15 - 20 kDa\nGenBank Accession Number: BC009078\nGene Symbol: C16orf74\nGene ID (NCBI): 404550\nRRID: AB_3086278\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96GX8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869645394089,"sku":"30246-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30246-1-ap","provider":"Iright","version":"1.0","type":"link"}