{"product_id":"proteintech-30254-1-ap","title":"Proteintech, 30254-1-AP, BLM Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BLM (30254-1-AP) by Proteintech is a Polyclonal antibody targeting BLM in WB, ELISA applications with reactivity to human, mouse samples\n30254-1-AP targets BLM in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, HEK-293T cells,  HeLa cells,  Jurkat cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBLM participates in DNA replication and repair, it is involved in 5'-end resection of DNA during double-strand break (DSB) repair. BLM can also be recruited by the KHDC3L-OOEP scaffold to DNA replication forks where it is retained by TRIM25 ubiquitination, it thereby promotes the restart of stalled replication forks.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32996 Product name: Recombinant human BLM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1235-1417 aa of Sequence: VHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDSSPGISLSSSRGPGRSAAEELDEEIPVSSHYFASKTRNERKRKKMPASQRSKRRKTASSGSKAKGGSATCRKISSKTKSSSIIGSSSASHTSQATSGANSKLGIMAPPKPINRPFLKPSYAFS Predict reactive species\nFull Name: Bloom syndrome, RecQ helicase-like\nCalculated Molecular Weight: 159 kDa\nObserved Molecular Weight: 160-175 kDa\nGene Symbol: BLM\nGene ID (NCBI): 641\nRRID: AB_3086282\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P54132\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869643264169,"sku":"30254-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30254-1-ap","provider":"Iright","version":"1.0","type":"link"}