{"product_id":"proteintech-30256-1-ap","title":"Proteintech, 30256-1-AP, DUSP5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DUSP5 (30256-1-AP) by Proteintech is a Polyclonal antibody targeting DUSP5 in WB, IP, ELISA applications with reactivity to human samples\n30256-1-AP targets DUSP5 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HCT 116 cells\nPositive IP detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDUSP5 (Dual specificity protein phosphatase 5) is also named as VH3. DUSP5, a member of DUSPs superfamily, is located in the nucleus and plays crucially regulatory roles in the signaling pathway transduction (PMID: 34169608). DUSP5 promotes the osteogenic differentiation of mesenchymal stromal cells (MSCs) by repressing SMAD1 signaling pathway in a SCP1\/2‐dependent manner (PMID: 34169608). DUSP5, which specifically dephosphorylates extracellular signal-regulated kinase (ERK1\/2), blocks pulmonary vascular smooth muscle cell proliferation (PMID: 34142888). DUSP5, an ERK1\/2-specific endogenous phosphatase, was expressed at low levels in CRC (PMID: 36526622). DUSP5, a member of the DUSP subfamily, is known to regulate cellular inflammation (PMID: 33361528).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32997 Product name: Recombinant human DUSP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 311-384 aa of NM_004419 Sequence: LQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC Predict reactive species\nFull Name: dual specificity phosphatase 5\nCalculated Molecular Weight: 42kd\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: NM_004419\nGene Symbol: DUSP5\nGene ID (NCBI): 1847\nRRID: AB_3669707\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16690\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869677211817,"sku":"30256-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30256-1-ap","provider":"Iright","version":"1.0","type":"link"}