{"product_id":"proteintech-30333-1-ap","title":"Proteintech, 30333-1-AP, FGF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FGF2 (30333-1-AP) by Proteintech is a Polyclonal antibody targeting FGF2 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n30333-1-AP targets FGF2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, SKOV-3 cells,  U-87 MG cells\nPositive IF\/ICC detected in: SKOV-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFibroblast growth factor-2 (FGF-2), also referred to as basic FGF, belongs to a family of growth factors that stimulate proliferation of cells of mesenchymal, epithelial and neuroectodermal origin. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in at least five different isoforms with distinct properties.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28653 Product name: Recombinant human FGF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 143-275 aa of NM_002006 Sequence: MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPG Predict reactive species\nFull Name: fibroblast growth factor 2 (basic)\nCalculated Molecular Weight: 31 aa\nObserved Molecular Weight: 21 kDa, 23 kDa\nGenBank Accession Number: NM_002006\nGene Symbol: FGF2\nGene ID (NCBI): 2247\nRRID: AB_3669711\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09038\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869683634345,"sku":"30333-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30333-1-ap","provider":"Iright","version":"1.0","type":"link"}