{"product_id":"proteintech-30388-1-ap","title":"Proteintech, 30388-1-AP, GPX4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPX4 (30388-1-AP) by Proteintech is a Polyclonal antibody targeting GPX4 in WB, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n30388-1-AP targets GPX4 in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, HL-60 cells,  HEK-293 cells,  Jurkat cells,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: rat testis tissue\nPositive IF-P detected in: rat testis tissue\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPX4 (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial) protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility.It has two isforms about 20KDa and 22KDa, respectively. GPX4 is a monomer,but it has a tendency to form higher mass oligomers (PMID:17630701). It presents primarily in testis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30650 Product name: Recombinant human GPX4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 107-197 aa of BC021567 Sequence: KQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF Predict reactive species\nFull Name: glutathione peroxidase 4 (phospholipid hydroperoxidase)\nObserved Molecular Weight: 18-23 kDa\nGenBank Accession Number: BC021567\nGene Symbol: GPX4\nGene ID (NCBI): 2879\nRRID: AB_3086304\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P36969\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868822458537,"sku":"30388-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30388-1-ap","provider":"Iright","version":"1.0","type":"link"}