{"product_id":"proteintech-30393-1-ap","title":"Proteintech, 30393-1-AP, TMED5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMED5 (30393-1-AP) by Proteintech is a Polyclonal antibody targeting TMED5 in WB, ELISA applications with reactivity to human, mouse, rat samples\n30393-1-AP targets TMED5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  MKN-45 cells,  NCI-H1299 cells,  mouse liver tissue,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMED5 ( transmembrane p24 trafficking protein 5) is highly expressed in cervical and bladder cancer cell lines. TMED5 promotes nuclear autophagy and the malignant behavior of cervical cancer cells (PMID:36530030). Moreover, TMED5 could interact with WNT7B and thus activate the canonical WNT-CTNNB1\/β-catenin signaling pathway (PMID:30394198).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33253 Product name: Recombinant human TMED5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 120-178 aa of BC070051 Sequence: IFFELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQILLR Predict reactive species\nFull Name: transmembrane emp24 protein transport domain containing 5\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC070051\nGene Symbol: TMED5\nGene ID (NCBI): 50999\nRRID: AB_3086307\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y3A6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887829766313,"sku":"30393-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30393-1-ap","provider":"Iright","version":"1.0","type":"link"}