{"product_id":"proteintech-30443-1-ap","title":"Proteintech, 30443-1-AP, SYNCRIP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SYNCRIP (30443-1-AP) by Proteintech is a Polyclonal antibody targeting SYNCRIP in WB, IF\/ICC, ELISA applications with reactivity to Human samples\n30443-1-AP targets SYNCRIP in WB, IF\/ICC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, THP-1 cells\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSynaptotagmin-binding, cytoplasmic RNA-interacting protein(SYNCRIP), also identified as hnRNP Q, involves in mRNA processing mechanisms. It's component of the CRD-mediated complex that promotes MYC mRNA stability. Also it is part of the APOB mRNA editosome complex and may modulate the postranscriptional C to U RNA-editing of the APOB mRNA through either by binding to A1CF (APOBEC1 complementation factor), to APOBEC1 or to RNA itself. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation\/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Interacts in vitro preferentially with poly(A) and poly(U) RNA sequences. As previously reported, the 65 and 74 kDa proteins corresponded to two isoforms of SYNCRIP produced from alternatively spliced mRNAs (PMID: 15340051).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31509 Product name: Recombinant human SYNCRIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 382-527 aa of BC032643 Sequence: KAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGYPPDYYGYEDYYDYYGYDYHNYRGGYEDPYYGYEDFQVGARGRGGRGARGAAPSRGRGAAPPRGRAGYSQRGGPGSARGVRGARGGAQQQRGRGQGKGVEAGPDLLQ Predict reactive species\nFull Name: synaptotagmin binding, cytoplasmic RNA interacting protein\nCalculated Molecular Weight: 623 aa, 70 kDa\nObserved Molecular Weight: 62-74 kDa\nGenBank Accession Number: BC032643\nGene Symbol: SYNCRIP\nGene ID (NCBI): 10492\nRRID: AB_3086317\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60506\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887820951721,"sku":"30443-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30443-1-ap","provider":"Iright","version":"1.0","type":"link"}