{"product_id":"proteintech-30457-1-ap","title":"Proteintech, 30457-1-AP, MUC20 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MUC20 (30457-1-AP) by Proteintech is a Polyclonal antibody targeting MUC20 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n30457-1-AP targets MUC20 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse liver tissue\nPositive IHC detected in: rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMUC20 contains serine, threonine, and proline-rich repeats in its extracellular domain and is likely to be extensively O-glycosylated. MUC20 blocks GRB2 recruitment to MET thus suppressing the GRB2-RAS pathway and inhibiting HGF-induced proliferation of MMP1 and MMP9 expression (PMID: 15314156). MUC20 is highly expressed in the kidney and localized in the proximal tubules but not in the glomerulus or distal tubules(PMID: 14565953). MUC20 was detected in most of the male urogenital tract epithelia, except for epididymis(PMID: 16997931). The expression of MUC20 is up-regulated in the kidneys of patients with immunoglobulin A nephropathy, in an animal model of lupus nephritis, and in mice with acute renal injury caused by cisplatin administration or unilateral ureteral obstruction(PMID: 14565953).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31867 Product name: Recombinant human MUC20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 400-555 aa of BC029267 Sequence: IEAGSAVGKTTSFAGSSASSYSPSEAALKNFTPSETLTTDIATKGPFPTSRDPLPSVPPTTTNSSRGTNSTLAKITTSAKTTMKPPTATPTTARTRPTTDMSAGENGGFLLLRLSVASPEDLTDPRVAERLMQQLHRELHAHAPHFQVSLLRVRRG Predict reactive species\nFull Name: mucin 20, cell surface associated\nCalculated Molecular Weight: 55 kDa, 71 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC029267\nGene Symbol: MUC20\nGene ID (NCBI): 200958\nRRID: AB_3086323\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N307\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887727333545,"sku":"30457-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30457-1-ap","provider":"Iright","version":"1.0","type":"link"}