{"product_id":"proteintech-30466-1-ap","title":"Proteintech, 30466-1-AP, SLC16A13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC16A13 (30466-1-AP) by Proteintech is a Polyclonal antibody targeting SLC16A13 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples\n30466-1-AP targets SLC16A13 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC16A13 (solute carrier family 16 member 13), which encodes the monocarboxylate transporter 13 (MCT13), is a susceptibility gene for type 2 diabetes and is expressed in the liver and duodenum (PMID: 37630718). SLC16A13 is a potential target for the treatment of type 2 diabetes and non-alcoholic fatty liver disease (PMID: 34211098).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33183 Product name: Recombinant human SLC16A13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 395-426 aa of BC142618 Sequence: FCFSTTTSGPQDLVTEALDTKVPLPKEGLEED Predict reactive species\nFull Name: solute carrier family 16, member 13 (monocarboxylic acid transporter 13)\nCalculated Molecular Weight: 426 aa, 45 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC142618\nGene Symbol: SLC16A13\nGene ID (NCBI): 201232\nRRID: AB_3086327\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7RTY0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887803715753,"sku":"30466-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30466-1-ap","provider":"Iright","version":"1.0","type":"link"}