{"product_id":"proteintech-30518-1-ap","title":"Proteintech, 30518-1-AP, WNT8A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WNT8A (30518-1-AP) by Proteintech is a Polyclonal antibody targeting WNT8A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, rat samples\n30518-1-AP targets WNT8A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, HT-29 cells,  SW480  cells,  rat heart tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HCT 116 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWNT8A,also named as WNT8D, belongs to the Wnt family of secreted signaling proteins. It is a ligand for members of the frizzled family of seven transmembrane receptors. These have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT8A may play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29510 Product name: Recombinant human WNT8A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 198-271 aa of NM_001300938 Sequence: LAEFREMGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWVPAEAFLPSAEAELIFLEESPDYCTCNSSLGIYGTE Predict reactive species\nFull Name: wingless-type MMTV integration site family, member 8A\nCalculated Molecular Weight: 39 kDa\nObserved Molecular Weight: 39-45 kDa\nGenBank Accession Number: NM_001300938\nGene Symbol: WNT8A\nGene ID (NCBI): 7478\nRRID: AB_3086345\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H1J5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887924400297,"sku":"30518-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30518-1-ap","provider":"Iright","version":"1.0","type":"link"}