{"product_id":"proteintech-30550-1-ap","title":"Proteintech, 30550-1-AP, SLFN12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLFN12 (30550-1-AP) by Proteintech is a Polyclonal antibody targeting SLFN12 in WB, IHC, ELISA applications with reactivity to human samples\n30550-1-AP targets SLFN12 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells, HEK-293 cells,  HeLa cells,  U2OS cells\nPositive IHC detected in: mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSchlafen family member 12 (SLFN12) is the only intermediate Schlafen protein expressed in humans (PMID: 31838790, PMID: 34571887). SLFN12 stimulates differentiation in enterocytes and prostate cancer cells, and its overexpression inhibits prostate cancer, triple-negative breast cancer (TNBC), and lung adenocarcinoma cell proliferation (PMID: 30045019, PMID: 24768141, PMID: 39594803). SLFN12 regulates human enterocytic differentiation by a pathway involving SERPB12, the deubiquitylases, and Cdx2 (PMID: 30045019). The expression of SLFN12 is increased throughout the process of T-cell activation (PMID: 28460425).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31289 Product name: Recombinant human SLFN12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 340-402 aa of BC035605 Sequence: FMVEAEPKFSSSYEEVISQINTSLPAPHSWPLLEWQRQRHHCPGLSGRITYTPENLCRKLFLQ Predict reactive species\nFull Name: schlafen family member 12\nCalculated Molecular Weight: 578 aa, 67 kDa\nObserved Molecular Weight: 67-70 kDa\nGenBank Accession Number: BC035605\nGene Symbol: SLFN12\nGene ID (NCBI): 55106\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IYM2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887808434345,"sku":"30550-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30550-1-ap","provider":"Iright","version":"1.0","type":"link"}