{"product_id":"proteintech-30580-1-ap","title":"Proteintech, 30580-1-AP, PSMA5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMA5 (30580-1-AP) by Proteintech is a Polyclonal antibody targeting PSMA5 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n30580-1-AP targets PSMA5 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HCT 116 cells,  HepG2 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProteasome subunit alpha type-5(PSMA5) is a component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. It binds to two 19S regulatory particles(RP) to form the 26S proteasome, an ATP-dependent multisubunit protease that degrades polyubiquitinated proteins into small peptides.(PMID: 26661102)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30703 Product name: Recombinant human PSMA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 120-241 aa of NM_002790 Sequence: ALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI Predict reactive species\nFull Name: proteasome (prosome, macropain) subunit, alpha type, 5\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: NM_002790\nGene Symbol: PSMA5\nGene ID (NCBI): 5686\nRRID: AB_3086368\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P28066\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887776059561,"sku":"30580-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30580-1-ap","provider":"Iright","version":"1.0","type":"link"}