{"product_id":"proteintech-30597-1-ap","title":"Proteintech, 30597-1-AP, ZYG11A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZYG11A (30597-1-AP) by Proteintech is a Polyclonal antibody targeting ZYG11A in WB, IF\/ICC, ELISA applications with reactivity to human samples\n30597-1-AP targets ZYG11A in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NCI-H1299 cells, HEK-293T cells,  HeLa cells\nPositive IF\/ICC detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZYG11A is a member of the Zyg11 protein family that functions as a target recruitment subunit of an E3 ubiquitin ligase complex playing a central role in the degradation of a regulatory protein involved in cell cycle regulation. ZYG11A is over-expressed in NSCLC tumor tissues and correlates with more aggressive clinical characteristics. Also ZYG11A gene constitutes a novel target for IGF1 action in endometrial cancer cells (PMID: 26771237, 31320996). This antibody is specific to isoform 2 of ZYG11A with a predicted molecular mass of 48 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30166 Product name: Recombinant human ZYG11A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 628-696 aa of NM_001004339 Sequence: TSDRQLWISRDFQRRTLLQDLHATIQNWPSSSCKMTALVTYRSFKTFFPLLGNFSQPEVQLWALWAMYH Predict reactive species\nFull Name: zyg-11 homolog A (C. elegans)\nCalculated Molecular Weight: 86 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: NM_001004339\nGene Symbol: ZYG11A\nGene ID (NCBI): 440590\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6WRX3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887954972841,"sku":"30597-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30597-1-ap","provider":"Iright","version":"1.0","type":"link"}