{"product_id":"proteintech-30599-1-ap","title":"Proteintech, 30599-1-AP, VCAN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VCAN (30599-1-AP) by Proteintech is a Polyclonal antibody targeting VCAN in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n30599-1-AP targets VCAN in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IHC detected in: human stomach cancer tissue, human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVersican, a component of the extracellular matrix and a member of the lectican family of proteoglycans, is the largest chondroitin sulfate proteoglycan and has an important role in the development of the heart, musculoskeletal system and central nervous system (CNS). The structure of versican is characterized by an approximately 550-kDa core protein consisting of an amino-terminal (G1) hyaluronan binding domain, a carboxy-terminal (G3) domain, and two central chondroitin sulfate glycosaminoglycan attachment domains, the α-GAG and β-GAG domains. Versican has four different isoforms that differ in the central GAG attachment domain: V0 (contains both α and β GAG domains), V1 (contains only the β domain), V2 (contains only the α domain) and V3 (devoid of both GAG domains)(PMID: 26385570).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30151 Product name: Recombinant human VCAN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 404-535 aa of NM_004385 Sequence: FEQKATVQPQAITDSLATKLPTPTGSTKKPWDMDDYSPSASGPLGKLDISEIKEEVLQSTTGVSHYATDSWDGVVEDKQTQESVTQIEQIEVGPLVTSMEILKHIPSKEFPVTETPLVTARMILESKTEKKM Predict reactive species\nFull Name: versican\nCalculated Molecular Weight: 373 kDa\nObserved Molecular Weight: 250-300 kDa, 550 kDa\nGenBank Accession Number: NM_004385\nGene Symbol: VCAN\nGene ID (NCBI): 1462\nRRID: AB_3669736\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13611\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869792325801,"sku":"30599-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30599-1-ap","provider":"Iright","version":"1.0","type":"link"}