{"product_id":"proteintech-30601-1-ap","title":"Proteintech, 30601-1-AP, Fas\/CD95 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Fas\/CD95 (30601-1-AP) by Proteintech is a Polyclonal antibody targeting Fas\/CD95 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n30601-1-AP targets Fas\/CD95 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, J774A.1 cells,  mouse brain tissue,  rat brain tissue\nPositive IF\/ICC detected in: Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAS, also named as CD95, APO-1, APT1, FAS1 and TNFRSF6, is a receptor for TNFSF6\/FASLG. It is a cell surface receptor belonging to the TNF receptor superfamily, can mediate apoptosis by ligation with an agonistic anti-Fas antibody or Fas ligand. Stimulation of Fas results in the aggregation of its intracellular death domains, leading to the formation of the death-inducing signaling complex (DISC). FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30426 Product name: Recombinant mouse Fas\/CD95 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-169 aa of NM_007987 Sequence: QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNR Predict reactive species\nFull Name: Fas (TNF receptor superfamily member 6)\nCalculated Molecular Weight: 37 kDa\nObserved Molecular Weight: 30-40 kDa\nGenBank Accession Number: NM_007987\nGene Symbol: Fas\/CD95\nGene ID (NCBI): 14102\nRRID: AB_3086371\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P25446\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869682061481,"sku":"30601-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30601-1-ap","provider":"Iright","version":"1.0","type":"link"}