{"product_id":"proteintech-30606-1-ap","title":"Proteintech, 30606-1-AP, OSR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OSR1 (30606-1-AP) by Proteintech is a Polyclonal antibody targeting OSR1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n30606-1-AP targets OSR1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse embryo tissue, rat bladder tissue\nPositive IHC detected in: mouse embryo tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOdd-skipped-related1(OSR1), contains 3 C2H3-type zinc fingers, a tyrosine phosphorylation site and several putative PXXP SH3 binding motifs. It's a transcription factor that has a role in embryonic heart and urogenital development. Expressed during the beginning stages of embryogenesis and during limb and branchial arch development, it possibly participarts in the metanephric kidney formation. OSR1 also plays a key role in the generation of kidney precursor cells and their subsequent differentiation into nephrons. OSR1 is upregulated in several pancreatic and esopha-geal cancer cell lines and downregulated in some primary gastric cancers\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31336 Product name: Recombinant human OSR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-168 aa of BC025712 Sequence: FANLALAATQEDPAKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLP Predict reactive species\nFull Name: odd-skipped related 1 (Drosophila)\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC025712\nGene Symbol: OSR1\nGene ID (NCBI): 130497\nRRID: AB_3669737\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TAX0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887747289257,"sku":"30606-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30606-1-ap","provider":"Iright","version":"1.0","type":"link"}