{"product_id":"proteintech-30613-1-ap","title":"Proteintech, 30613-1-AP, SOX14 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SOX14 (30613-1-AP) by Proteintech is a Polyclonal antibody targeting SOX14 in WB, ELISA applications with reactivity to human, mouse samples\n30613-1-AP targets SOX14 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSOX14, also known as SOX28, is a member of the SOX (SRY-related HMG-box) family of transcription factors. This intronless gene encodes a protein that acts as a transcriptional regulator after forming complexes with other proteins. It is involved in embryonic development and cell fate determination. SOX14 is primarily expressed in the nervous system, where it plays a role in neuronal differentiation and circuit formation. Mutations in SOX14 are suggested to be responsible for limb defects associated with conditions such as blepharophimosis, ptosis, epicanthus inversus syndrome (BPES), and Moebius syndrome. Additionally, SOX14 has been implicated in tumor development, with studies indicating its involvement in cervical cancer through mechanisms such as the p53 and Wnt\/β-catenin pathways. (PMID: 34098886, PMID: 34181293)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31127 Product name: Recombinant human SOX14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 85-155 aa of BC106730 Sequence: NLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLSAPEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEV Predict reactive species\nFull Name: SRY (sex determining region Y)-box 14\nCalculated Molecular Weight: 240 aa, 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC106730\nGene Symbol: SOX14\nGene ID (NCBI): 8403\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95416\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887812497577,"sku":"30613-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30613-1-ap","provider":"Iright","version":"1.0","type":"link"}