{"product_id":"proteintech-30615-1-ap","title":"Proteintech, 30615-1-AP, MMP11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MMP11 (30615-1-AP) by Proteintech is a Polyclonal antibody targeting MMP11 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n30615-1-AP targets MMP11 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, A549 cells,  T-47D cells\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMatrix metalloproteinase 11 (MMP11), also named stromelysin-3, is a member of the stromelysin subgroup belonging to MMPs superfamily. The role of MMP11 in cancer progression has been shown by several preclinical observations: its expression promotes tumor take in mice, homing of malignant epithelial cells, cancer progression by remodeling extracellular matrix, and antiapoptotic and antinecrotic effect on tumor cells (PMID: 19509157, 26892540). The immunoblot demonstrated two separate bands of ~65 kDa (latent proenzyme form) and ~45 kD (active form) of secreted MMP-11 protein (PMID: 21442356).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31191 Product name: Recombinant human MMP11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 99-208 aa of NM_005940 Sequence: VLSGGRWEKTDLTYRILRFPWQLVQEQVRQTMAEALKVWSDVTPLTFTEVHEGRADIMIDFARYWHGDDLPFDGPGGILAHAFFPKTHREGDVHFDYDETWTIGDDQGTD Predict reactive species\nFull Name: matrix metallopeptidase 11 (stromelysin 3)\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 45-55 kDa\nGenBank Accession Number: NM_005940\nGene Symbol: MMP11\nGene ID (NCBI): 4320\nRRID: AB_3086374\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P24347\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869560066217,"sku":"30615-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30615-1-ap","provider":"Iright","version":"1.0","type":"link"}