{"product_id":"proteintech-30631-1-ap","title":"Proteintech, 30631-1-AP, SLC25A4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC25A4 (30631-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A4 in WB, ELISA applications with reactivity to human, mouse samples\n30631-1-AP targets SLC25A4 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C2C12 cells, mouse brain tissue,  mouse heart tissue,  mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAdenine nucleotide translocators (ANTs) are mitochondrial carrier proteins that exchange ATP and ADP between the cytoplasm and the mitochondrial matrix. Four isoforms of ANT were identified: ANT1 (encoded by SLC25A4) is highly expressed in different tissues; ANT2 (encoded by SLC25A5) is predominantly expressed in proliferating, regenerating, or undifferentiated cells; ANT3 is ubiquitously expressed; ANT4 is mainly expressed in testis and germ cells. This antibody recognizes both of ANT1 and ANT2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33385 Product name: Recombinant human SLC25A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 131-178 aa of BC008664 Sequence: VYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFN Predict reactive species\nFull Name: solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC008664\nGene Symbol: SLC25A4\nGene ID (NCBI): 291\nRRID: AB_3086377\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P12235\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869765488809,"sku":"30631-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30631-1-ap","provider":"Iright","version":"1.0","type":"link"}