{"product_id":"proteintech-30656-1-ap","title":"Proteintech, 30656-1-AP, DAPK3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DAPK3 (30656-1-AP) by Proteintech is a Polyclonal antibody targeting DAPK3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n30656-1-AP targets DAPK3 in WB, IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HEK-293 cells,  Hela cells,  HepG2 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDAPK3, also named as ZIPK and Dlk, belongs to the protein kinase superfamily, CAMK Ser\/Thr protein kinase family and DAP kinase subfamily. The calculated molecular weight of DAPK3 is 52 kDa. This antibody can recognize the 37 kDa isoform of target. ZIP kinase is a Serine\/threonine kinase which acts as a positive regulator of apoptosis. ZIP kinasephosphorylates histone H3 on 'Thr-11' at centromeres during mitosis. ZIP kinase regulates myosin light chain phosphatase through phosphorylation of MYPT1 thereby regulating the assembly of the actin cytoskeleton, cell migration, invasiveness of tumor cells, smooth muscle contraction and neurite outgrowth. It catalyze the reaction: ATP + a protein = ADP + a phosphoprotein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33051 Product name: Recombinant human DAPK3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 252-361 aa of NM_001348 Sequence: IRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTTRLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIYE Predict reactive species\nFull Name: death-associated protein kinase 3\nCalculated Molecular Weight: 53 kDa\nObserved Molecular Weight: 37, 52 kDa\nGenBank Accession Number: NM_001348\nGene Symbol: DAPK3\nGene ID (NCBI): 1613\nRRID: AB_3086381\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43293\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869455667369,"sku":"30656-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30656-1-ap","provider":"Iright","version":"1.0","type":"link"}