{"product_id":"proteintech-30668-1-ap","title":"Proteintech, 30668-1-AP, PHEX Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PHEX (30668-1-AP) by Proteintech is a Polyclonal antibody targeting PHEX in WB, ELISA applications with reactivity to human, mouse, rat, hamster samples\n30668-1-AP targets PHEX in WB, ELISA applications and shows reactivity with human, mouse, rat, hamster samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: CHO cells, ROS1728 cells,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPhex encodes a 100- to 105-kDa transmembrane glycoprotein, which is present in bones and teeth of normal mice but not Hyp animals. Phex protein expression in femur and calvaria decreases with age, high levels of Phex detected in osteocytes make this protein an interesting marker to study the later stages of osteoblastic cell differentiation (PMID: 10934642). The 76 kDa represents the deglycosylated core-glycosylated forms within the ERs, the 95 kDa represents the core-glycosylated and unmatured form within the ERs, the 105 kDa species of PHEX protein represents the fully processed, matured for(PMID: 3251189, 35654784).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, hamster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33428 Product name: Recombinant human PHEX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 430-641 aa of BC105059 Sequence: DKKEMMEELVEGVRWAFIDMLEKENEWMDAGTKRKAKEKARAVLAKVGYPEFIMNDTHVNEDLKAIKFSEADYFGNVLQTRKYLAQSDFFWLRKAVPKTEWFTNPTTVNAFYSASTNQIRFPAGELQKPFFWGTEYPRSLSYGAIGVIVGHEFTHGFDNNGRKYDKNGNLDPWWSTESEEKFKEKTKCMINQYSNYYWKKAGLNVKGKRTLG Predict reactive species\nFull Name: phosphate regulating endopeptidase homolog, X-linked\nCalculated Molecular Weight: 749 aa, 86 kDa\nObserved Molecular Weight: 76-80 kDa, 95-100 kDa\nGenBank Accession Number: BC105059\nGene Symbol: PHEX\nGene ID (NCBI): 5251\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P78562\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887758594217,"sku":"30668-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30668-1-ap","provider":"Iright","version":"1.0","type":"link"}