{"product_id":"proteintech-30673-1-ap","title":"Proteintech, 30673-1-AP, MORF4L1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MORF4L1 (30673-1-AP) by Proteintech is a Polyclonal antibody targeting MORF4L1 in WB, ELISA applications with reactivity to Human samples\n30673-1-AP targets MORF4L1 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMORF4L1, also named as MRG15, belongs to the MRG family. It is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. It is also component of the mSin3A complex which acts to repress transcription by deacetylation of nucleosomal histones. (PMID:14966270) This antibody has no cross-reaction to MORF4L2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33839 Product name: Recombinant human MORF4L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC022845 Sequence: MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKK Predict reactive species\nFull Name: mortality factor 4 like 1\nCalculated Molecular Weight: 362 aa, 41 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC022845\nGene Symbol: MORF4L1\nGene ID (NCBI): 10933\nRRID: AB_3086384\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UBU8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887722090665,"sku":"30673-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30673-1-ap","provider":"Iright","version":"1.0","type":"link"}