{"product_id":"proteintech-30695-1-ap","title":"Proteintech, 30695-1-AP, GSDMD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GSDMD (30695-1-AP) by Proteintech is a Polyclonal antibody targeting GSDMD in WB, IP, ELISA applications with reactivity to mouse samples\n30695-1-AP targets GSDMD in WB, IP, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: EL-4 cells, EL-4-B5 cells,  NIH\/3T3 cells,  mouse liver tissue\nPositive IP detected in: RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGSDMD is a 53 kDa cytosolic protein and a member of the gasdermin protein family, which features 6 members in humans (GSDMA, -B, -C, -D, -E and -F. GSDMD was identified as the executioner of inflammasome-associated pyroptosis. Caspase-1, -11, or -4 cleave GSDMD after an aspartate residue within a central linker domain (D275 in humans and D276 in mice) to generate a 31-kDa N-terminal GSDMD fragment (GSDMD-NT) and a 22-kDa C-terminal fragment (GSDMD-CT). In addition to the canonical 31\/22 kDa cleavage products, a 43 kDa fragment has been observed under specific experimental or pathological conditions. The generation of the 43 kDa fragment was observed upon caspase-3 and -7 activation during apoptosis. This antibody can detect 53 kDa full-length GSDMD and 43 kDa fragment as described in the literature (PMID: 28392147, PMID: 28979266).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33609 Product name: Recombinant mouse Gsdmd protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 199-487 aa of BC029813 Sequence: GHQSRKKMVTIPAGSILAFRVAQLLIGSKWDILLVSDEKQRTFEPSSGDRKAVGQRHHGLNVLAALCSIGKQLSLLSDGIDEEELIEAADFQGLYAEVKACSSELESLEMELRQQILVNIGKILQDQPSMEALEASLGQGLCSGGQVEPLDGPAGCILECLVLDSGELVPELAAPIFYLLGALAVLSETQQQLLAKALETTVLSKQLELVKHVLEQSTPWQEQSSVSLPTVLLGDCWDEKNPTWVLLEECGLRLQVESPQVHWEPTSLIPTSALYASLFLLSSLGQKPC* Predict reactive species\nFull Name: gasdermin D\nCalculated Molecular Weight: 53 kDa\nObserved Molecular Weight: 50-53 kDa, 43 kDa\nGenBank Accession Number: BC029813\nGene Symbol: Gsdmd\nGene ID (NCBI): 69146\nRRID: AB_3086391\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9D8T2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869547155625,"sku":"30695-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30695-1-ap","provider":"Iright","version":"1.0","type":"link"}