{"product_id":"proteintech-30708-1-ap","title":"Proteintech, 30708-1-AP, PDE8B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDE8B (30708-1-AP) by Proteintech is a Polyclonal antibody targeting PDE8B in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n30708-1-AP targets PDE8B in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human placenta tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman phosphodiesterase (PDE) type 8B (PDE8B) is located at 5q14.1 and is known as the PDE with the highest affinity to cAMP.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33477 Product name: Recombinant human PDE8B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 374-440 aa of NM_003719 Sequence: FVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDVKSISSRGSDAPSLQNRRYPS Predict reactive species\nFull Name: phosphodiesterase 8B\nCalculated Molecular Weight: 99kd\nObserved Molecular Weight: 68-98 kDa\nGenBank Accession Number: NM_003719\nGene Symbol: PDE8B\nGene ID (NCBI): 8622\nRRID: AB_3086395\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95263\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887755120809,"sku":"30708-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30708-1-ap","provider":"Iright","version":"1.0","type":"link"}