{"product_id":"proteintech-30711-1-ap","title":"Proteintech, 30711-1-AP, SUSD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SUSD2 (30711-1-AP) by Proteintech is a Polyclonal antibody targeting SUSD2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n30711-1-AP targets SUSD2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SK-BR-3 cells, mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSushi domain containing 2 (SUSD2) is a type I transmembrane protein that contains a somatomedin B, AMOP, von Willebrand factor type D and Sushi domains, which are frequently found in molecules associated with cell-cell and cell-matrix adhesion. SUSD2 is composed of 822 amino acids with a predicted molecular weight of 90.4 kDa (PMID: 31387209). Three specific SUSD2 bands were present, the glycosylated, full-length protein (~110 kDa), ~90 kDa band represents full-length SUSD2 with minimal glycosylation, and a strong ~60 kDa band, represents a cleaved product of SUSD2 at the GD-PH sequence in the endoplasmic reticulum (PMID:27775699, 32595828).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33630 Product name: Recombinant human SUSD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 544-724 aa of NM_019601 Sequence: MDLKGMFLSVAAGDRVSIMLASGAGLEVSVQGPFLSVSVLLPEKFLTHTHGLLGTLNNDPTDDFTLHSGRVLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLVHNFLYQPKHDPTFEPLFPSETTLNPSLAQEAAKLCGDDHFCNFDVAATGSLSTGTATRVAHQLHQRRMQSLQPVVS* Predict reactive species\nFull Name: sushi domain containing 2\nCalculated Molecular Weight: 90 kDa\nObserved Molecular Weight: 60 kDa, 90 kDa, 110 kDa\nGenBank Accession Number: NM_019601\nGene Symbol: SUSD2\nGene ID (NCBI): 56241\nRRID: AB_3669753\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UGT4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887819968681,"sku":"30711-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30711-1-ap","provider":"Iright","version":"1.0","type":"link"}